Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076

  1. Avatar for erikviking 161. erikviking Lv 1 12 pts. 8,416
  2. Avatar for Lumbra74 162. Lumbra74 Lv 1 12 pts. 8,413
  3. Avatar for zannipietro 163. zannipietro Lv 1 12 pts. 8,410
  4. Avatar for x_sarah.beara_x 164. x_sarah.beara_x Lv 1 11 pts. 8,406
  5. Avatar for martinf 165. martinf Lv 1 11 pts. 8,405
  6. Avatar for Tlaloc 166. Tlaloc Lv 1 11 pts. 8,397
  7. Avatar for rylomorda 167. rylomorda Lv 1 11 pts. 8,385
  8. Avatar for zo3xiaJonWeinberg 168. zo3xiaJonWeinberg Lv 1 11 pts. 8,379
  9. Avatar for Candellila 169. Candellila Lv 1 10 pts. 8,377
  10. Avatar for hajtogato 170. hajtogato Lv 1 10 pts. 8,376

Comments