Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 90 pts. 9,113
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 89 pts. 9,112
  3. Avatar for robgee 13. robgee Lv 1 88 pts. 9,110
  4. Avatar for crpainter 14. crpainter Lv 1 87 pts. 9,096
  5. Avatar for silent gene 15. silent gene Lv 1 86 pts. 9,095
  6. Avatar for Scopper 16. Scopper Lv 1 85 pts. 9,084
  7. Avatar for TastyMunchies 17. TastyMunchies Lv 1 84 pts. 9,083
  8. Avatar for Phyx 18. Phyx Lv 1 83 pts. 9,081
  9. Avatar for O Seki To 19. O Seki To Lv 1 82 pts. 9,061
  10. Avatar for ZeroLeak7 20. ZeroLeak7 Lv 1 81 pts. 9,060

Comments