Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076

  1. Avatar for Pete Magnuson 231. Pete Magnuson Lv 1 3 pts. 8,195
  2. Avatar for ANU 232. ANU Lv 1 3 pts. 8,193
  3. Avatar for m.mehl 233. m.mehl Lv 1 3 pts. 8,191
  4. Avatar for yunifay 234. yunifay Lv 1 3 pts. 8,188
  5. Avatar for tlaran 235. tlaran Lv 1 3 pts. 8,186
  6. Avatar for Dijkgraaf 236. Dijkgraaf Lv 1 3 pts. 8,186
  7. Avatar for Kalverick 237. Kalverick Lv 1 3 pts. 8,184
  8. Avatar for swoehrmi 238. swoehrmi Lv 1 3 pts. 8,183
  9. Avatar for Teocady 239. Teocady Lv 1 3 pts. 8,181
  10. Avatar for Seenah0815 240. Seenah0815 Lv 1 3 pts. 8,180

Comments