Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for kirikiri 241. kirikiri Lv 1 3 pts. 8,179
  2. Avatar for RallexXx 242. RallexXx Lv 1 3 pts. 8,177
  3. Avatar for praveengill 243. praveengill Lv 1 3 pts. 8,176
  4. Avatar for Alec_C 244. Alec_C Lv 1 3 pts. 8,172
  5. Avatar for steveB 245. steveB Lv 1 3 pts. 8,169
  6. Avatar for Mabexer 246. Mabexer Lv 1 3 pts. 8,169
  7. Avatar for ShadowTactics 247. ShadowTactics Lv 1 3 pts. 8,168
  8. Avatar for gbr 248. gbr Lv 1 2 pts. 8,167
  9. Avatar for JosefKa 249. JosefKa Lv 1 2 pts. 8,164
  10. Avatar for harleyjharris 250. harleyjharris Lv 1 2 pts. 8,162

Comments