Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for andrikos 251. andrikos Lv 1 2 pts. 8,161
  2. Avatar for zurmad 252. zurmad Lv 1 2 pts. 8,161
  3. Avatar for Jane Tone 253. Jane Tone Lv 1 2 pts. 8,153
  4. Avatar for foldthestuffman 254. foldthestuffman Lv 1 2 pts. 8,152
  5. Avatar for WolliWolfsen 255. WolliWolfsen Lv 1 2 pts. 8,149
  6. Avatar for Rodrigo Weriky 256. Rodrigo Weriky Lv 1 2 pts. 8,147
  7. Avatar for chilifish 257. chilifish Lv 1 2 pts. 8,147
  8. Avatar for krikun420 258. krikun420 Lv 1 2 pts. 8,142
  9. Avatar for BoumkuK 259. BoumkuK Lv 1 2 pts. 8,140
  10. Avatar for falck 260. falck Lv 1 2 pts. 8,135

Comments