Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076

  1. Avatar for Dasmiley 291. Dasmiley Lv 1 1 pt. 8,082
  2. Avatar for kevin everington 292. kevin everington Lv 1 1 pt. 8,081
  3. Avatar for CatweazleJoe 293. CatweazleJoe Lv 1 1 pt. 8,079
  4. Avatar for xapeiron 294. xapeiron Lv 1 1 pt. 8,076
  5. Avatar for Trellin 295. Trellin Lv 1 1 pt. 8,075
  6. Avatar for Takainagi 296. Takainagi Lv 1 1 pt. 8,070
  7. Avatar for nomany 297. nomany Lv 1 1 pt. 8,067
  8. Avatar for Juli09 298. Juli09 Lv 1 1 pt. 8,067
  9. Avatar for steph43016 299. steph43016 Lv 1 1 pt. 8,066
  10. Avatar for Manderson7 300. Manderson7 Lv 1 1 pt. 8,064

Comments