Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for Pi3110 311. Pi3110 Lv 1 1 pt. 8,042
  2. Avatar for tomkhrustin 312. tomkhrustin Lv 1 1 pt. 8,041
  3. Avatar for froschi2 313. froschi2 Lv 1 1 pt. 8,041
  4. Avatar for Mireka 314. Mireka Lv 1 1 pt. 8,037
  5. Avatar for klippe 315. klippe Lv 1 1 pt. 8,036
  6. Avatar for oaks 316. oaks Lv 1 1 pt. 8,035
  7. Avatar for Hubertjuergens 317. Hubertjuergens Lv 1 1 pt. 8,032
  8. Avatar for argyrw 318. argyrw Lv 1 1 pt. 8,027
  9. Avatar for annasoiron1802 319. annasoiron1802 Lv 1 1 pt. 8,017
  10. Avatar for ds_83 320. ds_83 Lv 1 1 pt. 8,016

Comments