Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for Scherzelie 321. Scherzelie Lv 1 1 pt. 8,014
  2. Avatar for MinecraftMaster 322. MinecraftMaster Lv 1 1 pt. 8,012
  3. Avatar for MisterPJG 323. MisterPJG Lv 1 1 pt. 8,010
  4. Avatar for amarfx 324. amarfx Lv 1 1 pt. 8,010
  5. Avatar for cuttlingstop 325. cuttlingstop Lv 1 1 pt. 8,008
  6. Avatar for karmeitha 326. karmeitha Lv 1 1 pt. 8,008
  7. Avatar for bstraub 327. bstraub Lv 1 1 pt. 8,008
  8. Avatar for Steve-ATeam 328. Steve-ATeam Lv 1 1 pt. 8,006
  9. Avatar for Arke 329. Arke Lv 1 1 pt. 8,002
  10. Avatar for rmoretti 330. rmoretti Lv 1 1 pt. 8,001

Comments