Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for Wurstsalat 341. Wurstsalat Lv 1 1 pt. 7,966
  2. Avatar for lecona 342. lecona Lv 1 1 pt. 7,962
  3. Avatar for destinagenc 343. destinagenc Lv 1 1 pt. 7,960
  4. Avatar for Pravin Agarwal 344. Pravin Agarwal Lv 1 1 pt. 7,949
  5. Avatar for Speed-Noe-Austria 345. Speed-Noe-Austria Lv 1 1 pt. 7,948
  6. Avatar for inghoff 346. inghoff Lv 1 1 pt. 7,946
  7. Avatar for Pyrodinium123 347. Pyrodinium123 Lv 1 1 pt. 7,945
  8. Avatar for BiLo 348. BiLo Lv 1 1 pt. 7,944
  9. Avatar for Drake-NT 349. Drake-NT Lv 1 1 pt. 7,936
  10. Avatar for Lordi 350. Lordi Lv 1 1 pt. 7,935

Comments