Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for Wolf82 371. Wolf82 Lv 1 1 pt. 7,709
  2. Avatar for marsfan 372. marsfan Lv 1 1 pt. 7,709
  3. Avatar for Pistrix 373. Pistrix Lv 1 1 pt. 7,708
  4. Avatar for bennimarkus 374. bennimarkus Lv 1 1 pt. 7,692
  5. Avatar for digigo05 375. digigo05 Lv 1 1 pt. 7,688
  6. Avatar for schlaukopf 376. schlaukopf Lv 1 1 pt. 7,682
  7. Avatar for lyseblake 377. lyseblake Lv 1 1 pt. 7,673
  8. Avatar for Momo_17 378. Momo_17 Lv 1 1 pt. 7,668
  9. Avatar for aw2704 379. aw2704 Lv 1 1 pt. 7,661
  10. Avatar for Tetris81 380. Tetris81 Lv 1 1 pt. 7,652

Comments