Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076

  1. Avatar for KarenCH 31. KarenCH Lv 1 72 pts. 8,998
  2. Avatar for alyssa_d_V2.0 32. alyssa_d_V2.0 Lv 1 71 pts. 8,989
  3. Avatar for NinjaGreg 33. NinjaGreg Lv 1 70 pts. 8,984
  4. Avatar for Merf 34. Merf Lv 1 69 pts. 8,982
  5. Avatar for Deleted player 35. Deleted player 68 pts. 8,978
  6. Avatar for HerobrinesArmy 36. HerobrinesArmy Lv 1 68 pts. 8,977
  7. Avatar for GuR0 37. GuR0 Lv 1 67 pts. 8,976
  8. Avatar for harvardman 38. harvardman Lv 1 66 pts. 8,971
  9. Avatar for Deet 39. Deet Lv 1 65 pts. 8,967
  10. Avatar for Keresto 40. Keresto Lv 1 64 pts. 8,962

Comments