Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for Dreamygirl48 401. Dreamygirl48 Lv 1 1 pt. 6,410
  2. Avatar for Protcore 402. Protcore Lv 1 1 pt. 6,401
  3. Avatar for Mellania 403. Mellania Lv 1 1 pt. 6,379
  4. Avatar for Sleine 404. Sleine Lv 1 1 pt. 6,345
  5. Avatar for MIchaelBraunschmidt 405. MIchaelBraunschmidt Lv 1 1 pt. 6,345
  6. Avatar for Hanisa 406. Hanisa Lv 1 1 pt. 6,334
  7. Avatar for Finn Grotkopf 407. Finn Grotkopf Lv 1 1 pt. 6,315
  8. Avatar for Domnom_09 408. Domnom_09 Lv 1 1 pt. 6,297
  9. Avatar for Checker Kev 409. Checker Kev Lv 1 1 pt. 6,281
  10. Avatar for RRMACEDO 410. RRMACEDO Lv 1 1 pt. 6,279

Comments