Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for AndrejsAnfimovsRiga 411. AndrejsAnfimovsRiga Lv 1 1 pt. 6,277
  2. Avatar for ThOrtmeier 412. ThOrtmeier Lv 1 1 pt. 6,238
  3. Avatar for oxien97 413. oxien97 Lv 1 1 pt. 6,236
  4. Avatar for Paprika55 414. Paprika55 Lv 1 1 pt. 6,223
  5. Avatar for OliverSiegmund 415. OliverSiegmund Lv 1 1 pt. 6,219
  6. Avatar for Tom der Beste 416. Tom der Beste Lv 1 1 pt. 6,213
  7. Avatar for chubidubiman 417. chubidubiman Lv 1 1 pt. 6,209
  8. Avatar for vaskania 418. vaskania Lv 1 1 pt. 6,179
  9. Avatar for Sprint 419. Sprint Lv 1 1 pt. 6,166
  10. Avatar for Hphone123 420. Hphone123 Lv 1 1 pt. 6,131

Comments