Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for robsen 431. robsen Lv 1 1 pt. 5,696
  2. Avatar for Micha Fischer 432. Micha Fischer Lv 1 1 pt. 5,091
  3. Avatar for Karoklavier 433. Karoklavier Lv 1 1 pt. 5,091
  4. Avatar for Rosee83 434. Rosee83 Lv 1 1 pt. 5,091
  5. Avatar for FelixT. 435. FelixT. Lv 1 1 pt. 5,091
  6. Avatar for Mariella2020 436. Mariella2020 Lv 1 1 pt. 5,091
  7. Avatar for henryjohn32 437. henryjohn32 Lv 1 1 pt. 5,091
  8. Avatar for phi16 438. phi16 Lv 1 1 pt. 5,091
  9. Avatar for ZHUJINGJING 439. ZHUJINGJING Lv 1 1 pt. 5,091
  10. Avatar for janithas 440. janithas Lv 1 1 pt. 5,091

Comments