Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076

  1. Avatar for Freaser 441. Freaser Lv 1 1 pt. 5,091
  2. Avatar for Adhere95 442. Adhere95 Lv 1 1 pt. 5,091
  3. Avatar for Gudi 443. Gudi Lv 1 1 pt. 5,091
  4. Avatar for MOMI 444. MOMI Lv 1 1 pt. 5,091
  5. Avatar for rosegris 445. rosegris Lv 1 1 pt. 5,091
  6. Avatar for florianp2020 446. florianp2020 Lv 1 1 pt. 5,091
  7. Avatar for Tony_Jin 447. Tony_Jin Lv 1 1 pt. 5,091
  8. Avatar for bkoep 448. bkoep Lv 1 1 pt. 5,091
  9. Avatar for brandon13231234124 449. brandon13231234124 Lv 1 1 pt. 5,091
  10. Avatar for Ignacio 450. Ignacio Lv 1 1 pt. 5,091

Comments