Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for puxatudo 451. puxatudo Lv 1 1 pt. 5,091
  2. Avatar for HazelPath 452. HazelPath Lv 1 1 pt. 5,091
  3. Avatar for Pladdin 453. Pladdin Lv 1 1 pt. 5,091
  4. Avatar for 3rdwave 454. 3rdwave Lv 1 1 pt. 5,091
  5. Avatar for Wipf 455. Wipf Lv 1 1 pt. 5,091
  6. Avatar for passscoed 456. passscoed Lv 1 1 pt. 5,091

Comments