Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for haabermaaster 41. haabermaaster Lv 1 64 pts. 8,960
  2. Avatar for DoctorSockrates 42. DoctorSockrates Lv 1 63 pts. 8,951
  3. Avatar for Deleted player 43. Deleted player 62 pts. 8,949
  4. Avatar for jausmh 44. jausmh Lv 1 61 pts. 8,940
  5. Avatar for pauldunn 45. pauldunn Lv 1 61 pts. 8,935
  6. Avatar for OWM3 46. OWM3 Lv 1 60 pts. 8,933
  7. Avatar for SWR_DMaster 47. SWR_DMaster Lv 1 59 pts. 8,931
  8. Avatar for Crossed Sticks 48. Crossed Sticks Lv 1 58 pts. 8,931
  9. Avatar for tangofox10 49. tangofox10 Lv 1 58 pts. 8,923
  10. Avatar for Renthel 50. Renthel Lv 1 57 pts. 8,922

Comments