Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076

  1. Avatar for Vinara 51. Vinara Lv 1 56 pts. 8,914
  2. Avatar for Steven Pletsch 52. Steven Pletsch Lv 1 56 pts. 8,911
  3. Avatar for stomjoh 53. stomjoh Lv 1 55 pts. 8,909
  4. Avatar for pvc78 54. pvc78 Lv 1 54 pts. 8,900
  5. Avatar for katling 55. katling Lv 1 54 pts. 8,891
  6. Avatar for samchop 56. samchop Lv 1 53 pts. 8,886
  7. Avatar for Deleted player 57. Deleted player pts. 8,879
  8. Avatar for Flagg65a 58. Flagg65a Lv 1 52 pts. 8,875
  9. Avatar for cbwest 59. cbwest Lv 1 51 pts. 8,869
  10. Avatar for kathy65 60. kathy65 Lv 1 50 pts. 8,866

Comments