Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for TheGUmmer 61. TheGUmmer Lv 1 50 pts. 8,852
  2. Avatar for jsfoldingaccount 62. jsfoldingaccount Lv 1 49 pts. 8,847
  3. Avatar for heather-1 63. heather-1 Lv 1 49 pts. 8,840
  4. Avatar for WBarme1234 64. WBarme1234 Lv 1 48 pts. 8,837
  5. Avatar for pangaena 65. pangaena Lv 1 47 pts. 8,835
  6. Avatar for firejuggler 66. firejuggler Lv 1 47 pts. 8,834
  7. Avatar for alcor29 67. alcor29 Lv 1 46 pts. 8,826
  8. Avatar for frood66 68. frood66 Lv 1 46 pts. 8,821
  9. Avatar for Pawel Tluscik 69. Pawel Tluscik Lv 1 45 pts. 8,820
  10. Avatar for abiogenesis 70. abiogenesis Lv 1 44 pts. 8,809

Comments