Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076

  1. Avatar for Ertonier 81. Ertonier Lv 1 39 pts. 8,757
  2. Avatar for motu 82. motu Lv 1 38 pts. 8,742
  3. Avatar for Vman 83. Vman Lv 1 38 pts. 8,739
  4. Avatar for JasperD 84. JasperD Lv 1 37 pts. 8,737
  5. Avatar for pfirth 85. pfirth Lv 1 37 pts. 8,736
  6. Avatar for fujioyama 86. fujioyama Lv 1 36 pts. 8,736
  7. Avatar for xythus 87. xythus Lv 1 36 pts. 8,731
  8. Avatar for donuts554 88. donuts554 Lv 1 35 pts. 8,728
  9. Avatar for Pibeagles1 89. Pibeagles1 Lv 1 35 pts. 8,712
  10. Avatar for fpc 90. fpc Lv 1 34 pts. 8,707

Comments