Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996

  1. Avatar for pente_player 11. pente_player Lv 1 6 pts. 9,127
  2. Avatar for silent gene 12. silent gene Lv 1 4 pts. 9,087
  3. Avatar for Scopper 13. Scopper Lv 1 3 pts. 9,081
  4. Avatar for Amphimixus 14. Amphimixus Lv 1 2 pts. 9,081
  5. Avatar for pauldunn 15. pauldunn Lv 1 1 pt. 9,076
  6. Avatar for Bruno Kestemont 16. Bruno Kestemont Lv 1 1 pt. 9,067
  7. Avatar for O Seki To 17. O Seki To Lv 1 1 pt. 9,059
  8. Avatar for samchop 18. samchop Lv 1 1 pt. 9,023
  9. Avatar for ManVsYard 19. ManVsYard Lv 1 1 pt. 8,989
  10. Avatar for Jpilkington 20. Jpilkington Lv 1 1 pt. 8,986

Comments