1816: Revisiting Puzzle 109: Pumpkin

Closed since almost 6 years ago

Summary

• Created: March 24, 2020
• Expires: April 01, 2020 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:

SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

• 1. Anthropic Dreams 100 pts. 9,246
• 2. L'Alliance Francophone 81 pts. 9,221
• 3. Beta Folders 64 pts. 9,162
• 4. Go Science 50 pts. 9,139
• 5. HMT heritage 39 pts. 9,061
• 6. Team India 30 pts. 9,055
• 7. Gargleblasters 23 pts. 9,025
• 8. Contenders 17 pts. 9,024
• 9. Void Crushers 12 pts. 9,001
• 10. SETI.Germany 9 pts. 8,996

Top evolvers

• 21. fpc 1 pt. 8,984
• 22. puxatudo 1 pt. 8,972
• 23. knotartist 1 pt. 8,897
• 24. jausmh 1 pt. 8,658

Comments

[LociOiling]

https://foldit.fandom.com/wiki/Revisiting_puzzle/109:_Pumpkin

Like the previous revisiting puzzle, the expiration time on this one is 5 hours later than normal. It's set to expire at 23:00 UTC/GMT, where revisiting puzzles normally expire at 18:00 UTC/GMT.

Puzzle 1813: Revisiting Puzzle 97: Pig was set up the same way, but actually expired at 18:00 UTC, the customary time.

Don't count on the five extra hours! (Sad experience here.)