Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996

  1. Avatar for Fructose6phosphateAA 271. Fructose6phosphateAA Lv 1 2 pts. 8,117
  2. Avatar for Sammy3c2b1a0 272. Sammy3c2b1a0 Lv 1 2 pts. 8,115
  3. Avatar for SueCerlier 273. SueCerlier Lv 1 2 pts. 8,115
  4. Avatar for tosimasa 274. tosimasa Lv 1 2 pts. 8,115
  5. Avatar for deagleigel 275. deagleigel Lv 1 1 pt. 8,113
  6. Avatar for Swapper242 276. Swapper242 Lv 1 1 pt. 8,112
  7. Avatar for Loponia 277. Loponia Lv 1 1 pt. 8,112
  8. Avatar for speedy201 278. speedy201 Lv 1 1 pt. 8,112
  9. Avatar for Franzi2011 279. Franzi2011 Lv 1 1 pt. 8,110
  10. Avatar for WoutSCC 280. WoutSCC Lv 1 1 pt. 8,106

Comments