Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996

  1. Avatar for g_b 71. g_b Lv 1 44 pts. 8,808
  2. Avatar for SKSbell 72. SKSbell Lv 1 43 pts. 8,807
  3. Avatar for dahast.de 73. dahast.de Lv 1 43 pts. 8,801
  4. Avatar for Hellcat6 74. Hellcat6 Lv 1 42 pts. 8,791
  5. Avatar for Serca 75. Serca Lv 1 42 pts. 8,786
  6. Avatar for alwen 76. alwen Lv 1 41 pts. 8,785
  7. Avatar for Tygh 77. Tygh Lv 1 41 pts. 8,784
  8. Avatar for LastAndroid 78. LastAndroid Lv 1 40 pts. 8,766
  9. Avatar for Spielteufel 79. Spielteufel Lv 1 40 pts. 8,761
  10. Avatar for keithv 80. keithv Lv 1 39 pts. 8,760

Comments