Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996
  1. Avatar for David_Mattern 281. David_Mattern Lv 1 1 pt. 8,106
  2. Avatar for Lassy33 282. Lassy33 Lv 1 1 pt. 8,105
  3. Avatar for Pazithi 283. Pazithi Lv 1 1 pt. 8,102
  4. Avatar for aminokwas 284. aminokwas Lv 1 1 pt. 8,102
  5. Avatar for Bluemchenbande 285. Bluemchenbande Lv 1 1 pt. 8,095
  6. Avatar for holtwick 286. holtwick Lv 1 1 pt. 8,094
  7. Avatar for DipsyDoodle2016 287. DipsyDoodle2016 Lv 1 1 pt. 8,093
  8. Avatar for Peebee94 288. Peebee94 Lv 1 1 pt. 8,090
  9. Avatar for Hanoman777 289. Hanoman777 Lv 1 1 pt. 8,087
  10. Avatar for Arsal 290. Arsal Lv 1 1 pt. 8,085

Comments