Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996
  1. Avatar for TECHFREAK 21. TECHFREAK Lv 1 80 pts. 9,055
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 79 pts. 9,027
  3. Avatar for Blipperman 23. Blipperman Lv 1 79 pts. 9,025
  4. Avatar for georg137 24. georg137 Lv 1 78 pts. 9,024
  5. Avatar for joremen 25. joremen Lv 1 77 pts. 9,023
  6. Avatar for nicobul 26. nicobul Lv 1 76 pts. 9,017
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 75 pts. 9,017
  8. Avatar for Xartos 28. Xartos Lv 1 74 pts. 9,015
  9. Avatar for aznarog 29. aznarog Lv 1 73 pts. 9,008
  10. Avatar for spdenne 30. spdenne Lv 1 72 pts. 9,001

Comments