Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,246
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 81 pts. 9,221
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 9,162
  4. Avatar for Go Science 4. Go Science 50 pts. 9,139
  5. Avatar for HMT heritage 5. HMT heritage 39 pts. 9,061
  6. Avatar for Team India 6. Team India 30 pts. 9,055
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,025
  8. Avatar for Contenders 8. Contenders 17 pts. 9,024
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,001
  10. Avatar for SETI.Germany 10. SETI.Germany 9 pts. 8,996
  1. Avatar for Ricmondka6 391. Ricmondka6 Lv 1 1 pt. 7,575
  2. Avatar for AKTS_Tony 392. AKTS_Tony Lv 1 1 pt. 7,538
  3. Avatar for Saskia1408 393. Saskia1408 Lv 1 1 pt. 7,530
  4. Avatar for Tim_1717 394. Tim_1717 Lv 1 1 pt. 7,517
  5. Avatar for Gianfranco72 395. Gianfranco72 Lv 1 1 pt. 7,478
  6. Avatar for Bioxandr 396. Bioxandr Lv 1 1 pt. 7,136
  7. Avatar for Bogert 397. Bogert Lv 1 1 pt. 6,579
  8. Avatar for Lars45 398. Lars45 Lv 1 1 pt. 6,506
  9. Avatar for hieu15 399. hieu15 Lv 1 1 pt. 6,493
  10. Avatar for NebucadHRO 400. NebucadHRO Lv 1 1 pt. 6,488

Comments