Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 9 pts. 10,135
  2. Avatar for Penny-Arcade 12. Penny-Arcade 7 pts. 10,068
  3. Avatar for Hold My Beer 13. Hold My Beer 5 pts. 10,063
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 4 pts. 10,049
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 3 pts. 9,875
  6. Avatar for Trinity Biology 16. Trinity Biology 2 pts. 9,835
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 9,726
  8. Avatar for CHNO Junkies 18. CHNO Junkies 1 pt. 9,492
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,860
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,758
  1. Avatar for Prateek_vikram42 141. Prateek_vikram42 Lv 1 8 pts. 9,418
  2. Avatar for haggisfam 142. haggisfam Lv 1 8 pts. 9,393
  3. Avatar for foldit109ljsd 143. foldit109ljsd Lv 1 8 pts. 9,393
  4. Avatar for ytum21 144. ytum21 Lv 1 8 pts. 9,388
  5. Avatar for evifnoskcaj 145. evifnoskcaj Lv 1 8 pts. 9,372
  6. Avatar for bergie72 146. bergie72 Lv 1 8 pts. 9,366
  7. Avatar for firejuggler 147. firejuggler Lv 1 7 pts. 9,364
  8. Avatar for ExcitableMonkey 148. ExcitableMonkey Lv 1 7 pts. 9,357
  9. Avatar for TheGUmmer 149. TheGUmmer Lv 1 7 pts. 9,349
  10. Avatar for kevin everington 150. kevin everington Lv 1 7 pts. 9,347

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…