Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 9 pts. 10,135
  2. Avatar for Penny-Arcade 12. Penny-Arcade 7 pts. 10,068
  3. Avatar for Hold My Beer 13. Hold My Beer 5 pts. 10,063
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 4 pts. 10,049
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 3 pts. 9,875
  6. Avatar for Trinity Biology 16. Trinity Biology 2 pts. 9,835
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 9,726
  8. Avatar for CHNO Junkies 18. CHNO Junkies 1 pt. 9,492
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,860
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,758
  1. Avatar for TastyMunchies 11. TastyMunchies Lv 1 87 pts. 10,407
  2. Avatar for O Seki To 12. O Seki To Lv 1 86 pts. 10,395
  3. Avatar for Deleted player 13. Deleted player 85 pts. 10,389
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 83 pts. 10,386
  5. Avatar for johnmitch 15. johnmitch Lv 1 82 pts. 10,382
  6. Avatar for robgee 16. robgee Lv 1 81 pts. 10,338
  7. Avatar for Mike Lewis 17. Mike Lewis Lv 1 80 pts. 10,334
  8. Avatar for diamonddays 18. diamonddays Lv 1 79 pts. 10,317
  9. Avatar for nicobul 19. nicobul Lv 1 77 pts. 10,305
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 76 pts. 10,294

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…