Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 9 pts. 10,135
  2. Avatar for Penny-Arcade 12. Penny-Arcade 7 pts. 10,068
  3. Avatar for Hold My Beer 13. Hold My Beer 5 pts. 10,063
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 4 pts. 10,049
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 3 pts. 9,875
  6. Avatar for Trinity Biology 16. Trinity Biology 2 pts. 9,835
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 9,726
  8. Avatar for CHNO Junkies 18. CHNO Junkies 1 pt. 9,492
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,860
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,758
  1. Avatar for jojo2525 241. jojo2525 Lv 1 1 pt. 8,404
  2. Avatar for Dijkgraaf 242. Dijkgraaf Lv 1 1 pt. 8,396
  3. Avatar for Mikisp 243. Mikisp Lv 1 1 pt. 8,383
  4. Avatar for GAVENvonAHYO 244. GAVENvonAHYO Lv 1 1 pt. 8,365
  5. Avatar for lilithness 245. lilithness Lv 1 1 pt. 8,360
  6. Avatar for YellowBearPL 246. YellowBearPL Lv 1 1 pt. 8,356
  7. Avatar for Swapper242 247. Swapper242 Lv 1 1 pt. 8,337
  8. Avatar for Cicero Rodrigues da Silva 248. Cicero Rodrigues da Silva Lv 1 1 pt. 8,334
  9. Avatar for Mika Yu 249. Mika Yu Lv 1 1 pt. 8,328
  10. Avatar for nalattappo 250. nalattappo Lv 1 1 pt. 8,328

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…