Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 9 pts. 10,135
  2. Avatar for Penny-Arcade 12. Penny-Arcade 7 pts. 10,068
  3. Avatar for Hold My Beer 13. Hold My Beer 5 pts. 10,063
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 4 pts. 10,049
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 3 pts. 9,875
  6. Avatar for Trinity Biology 16. Trinity Biology 2 pts. 9,835
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 9,726
  8. Avatar for CHNO Junkies 18. CHNO Junkies 1 pt. 9,492
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,860
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,758
  1. Avatar for DevHunter 281. DevHunter Lv 1 1 pt. 8,070
  2. Avatar for mb777 282. mb777 Lv 1 1 pt. 8,058
  3. Avatar for uziom 283. uziom Lv 1 1 pt. 8,057
  4. Avatar for Jadfarran 284. Jadfarran Lv 1 1 pt. 8,013
  5. Avatar for mxo4436 285. mxo4436 Lv 1 1 pt. 8,008
  6. Avatar for cro0815 286. cro0815 Lv 1 1 pt. 8,007
  7. Avatar for terminaphil 287. terminaphil Lv 1 1 pt. 7,993
  8. Avatar for Pyrodinium123 288. Pyrodinium123 Lv 1 1 pt. 7,987
  9. Avatar for west.elsdon 289. west.elsdon Lv 1 1 pt. 7,975
  10. Avatar for bobby2904 290. bobby2904 Lv 1 1 pt. 7,930

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…