Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 9 pts. 10,135
  2. Avatar for Penny-Arcade 12. Penny-Arcade 7 pts. 10,068
  3. Avatar for Hold My Beer 13. Hold My Beer 5 pts. 10,063
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 4 pts. 10,049
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 3 pts. 9,875
  6. Avatar for Trinity Biology 16. Trinity Biology 2 pts. 9,835
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 9,726
  8. Avatar for CHNO Junkies 18. CHNO Junkies 1 pt. 9,492
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,860
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,758
  1. Avatar for grogar7 21. grogar7 Lv 1 75 pts. 10,293
  2. Avatar for KarenCH 22. KarenCH Lv 1 74 pts. 10,279
  3. Avatar for Vinara 23. Vinara Lv 1 73 pts. 10,265
  4. Avatar for silent gene 24. silent gene Lv 1 72 pts. 10,249
  5. Avatar for jobo0502 25. jobo0502 Lv 1 71 pts. 10,246
  6. Avatar for Galaxie 26. Galaxie Lv 1 70 pts. 10,233
  7. Avatar for TECHFREAK 27. TECHFREAK Lv 1 69 pts. 10,227
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 68 pts. 10,225
  9. Avatar for aznarog 29. aznarog Lv 1 67 pts. 10,221
  10. Avatar for SWR_DMaster 30. SWR_DMaster Lv 1 66 pts. 10,213

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…