Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 9 pts. 10,135
  2. Avatar for Penny-Arcade 12. Penny-Arcade 7 pts. 10,068
  3. Avatar for Hold My Beer 13. Hold My Beer 5 pts. 10,063
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 4 pts. 10,049
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 3 pts. 9,875
  6. Avatar for Trinity Biology 16. Trinity Biology 2 pts. 9,835
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 9,726
  8. Avatar for CHNO Junkies 18. CHNO Junkies 1 pt. 9,492
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,860
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,758
  1. Avatar for Xavier Fontanals 301. Xavier Fontanals Lv 1 1 pt. 7,564
  2. Avatar for IHC 302. IHC Lv 1 1 pt. 7,548
  3. Avatar for gugugu 303. gugugu Lv 1 1 pt. 7,539
  4. Avatar for 3rdwave 304. 3rdwave Lv 1 1 pt. 7,533
  5. Avatar for Kahrijana 305. Kahrijana Lv 1 1 pt. 7,533
  6. Avatar for Tiger J 306. Tiger J Lv 1 1 pt. 7,503
  7. Avatar for haha2mal 307. haha2mal Lv 1 1 pt. 7,497
  8. Avatar for edioff 308. edioff Lv 1 1 pt. 7,492
  9. Avatar for ElmoTNT22 309. ElmoTNT22 Lv 1 1 pt. 7,401
  10. Avatar for jacob_n 310. jacob_n Lv 1 1 pt. 7,398

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…