Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 9 pts. 10,135
  2. Avatar for Penny-Arcade 12. Penny-Arcade 7 pts. 10,068
  3. Avatar for Hold My Beer 13. Hold My Beer 5 pts. 10,063
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 4 pts. 10,049
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 3 pts. 9,875
  6. Avatar for Trinity Biology 16. Trinity Biology 2 pts. 9,835
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 9,726
  8. Avatar for CHNO Junkies 18. CHNO Junkies 1 pt. 9,492
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,860
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,758
  1. Avatar for Soreneo 321. Soreneo Lv 1 1 pt. 5,978
  2. Avatar for samiak 322. samiak Lv 1 1 pt. 5,941
  3. Avatar for CrCon202 323. CrCon202 Lv 1 1 pt. 5,906
  4. Avatar for mitinkun 324. mitinkun Lv 1 1 pt. 5,609
  5. Avatar for Philipp_tesa 325. Philipp_tesa Lv 1 1 pt. 5,531
  6. Avatar for Coribee 326. Coribee Lv 1 1 pt. 5,497
  7. Avatar for jan and lea 327. jan and lea Lv 1 1 pt. 5,397
  8. Avatar for AllesWirdGut 328. AllesWirdGut Lv 1 1 pt. 5,300
  9. Avatar for Onur Dogan 329. Onur Dogan Lv 1 1 pt. 5,300
  10. Avatar for Takashi_Yoshida 330. Takashi_Yoshida Lv 1 1 pt. 5,290

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…