Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 9 pts. 10,135
  2. Avatar for Penny-Arcade 12. Penny-Arcade 7 pts. 10,068
  3. Avatar for Hold My Beer 13. Hold My Beer 5 pts. 10,063
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 4 pts. 10,049
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 3 pts. 9,875
  6. Avatar for Trinity Biology 16. Trinity Biology 2 pts. 9,835
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 9,726
  8. Avatar for CHNO Junkies 18. CHNO Junkies 1 pt. 9,492
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,860
  10. Avatar for Mojo Risin' 20. Mojo Risin' 1 pt. 8,758

  1. Avatar for Jpilkington 71. Jpilkington Lv 1 34 pts. 9,903
  2. Avatar for Simek 72. Simek Lv 1 33 pts. 9,890
  3. Avatar for Alistair69 73. Alistair69 Lv 1 32 pts. 9,884
  4. Avatar for versat82 74. versat82 Lv 1 32 pts. 9,875
  5. Avatar for Vman 75. Vman Lv 1 31 pts. 9,874
  6. Avatar for wudoo 76. wudoo Lv 1 31 pts. 9,873
  7. Avatar for alyssa_d_V2.0 77. alyssa_d_V2.0 Lv 1 30 pts. 9,835
  8. Avatar for Evica 78. Evica Lv 1 30 pts. 9,830
  9. Avatar for jsfoldingaccount 79. jsfoldingaccount Lv 1 29 pts. 9,810
  10. Avatar for harvardman 80. harvardman Lv 1 29 pts. 9,787

Comments


O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…