Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122
  7. Avatar for Auburn University BIOL 3000 Genetics 27. Auburn University BIOL 3000 Genetics 1 pt. 5,122
  1. Avatar for JasperD 91. JasperD Lv 1 23 pts. 9,738
  2. Avatar for cinnamonkitty 92. cinnamonkitty Lv 1 23 pts. 9,730
  3. Avatar for zeluis 93. zeluis Lv 1 23 pts. 9,728
  4. Avatar for ShadowTactics 94. ShadowTactics Lv 1 22 pts. 9,726
  5. Avatar for RonjaRonja 95. RonjaRonja Lv 1 22 pts. 9,712
  6. Avatar for rezaefar 96. rezaefar Lv 1 21 pts. 9,706
  7. Avatar for infjamc 97. infjamc Lv 1 21 pts. 9,696
  8. Avatar for yaksari 98. yaksari Lv 1 21 pts. 9,687
  9. Avatar for Glen B 99. Glen B Lv 1 20 pts. 9,686
  10. Avatar for JFB 238 100. JFB 238 Lv 1 20 pts. 9,685

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…