Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122
  7. Avatar for Auburn University BIOL 3000 Genetics 27. Auburn University BIOL 3000 Genetics 1 pt. 5,122
  1. Avatar for hajtogato 151. hajtogato Lv 1 7 pts. 9,332
  2. Avatar for badgoes 152. badgoes Lv 1 7 pts. 9,327
  3. Avatar for cjddig 153. cjddig Lv 1 6 pts. 9,323
  4. Avatar for Alec_C 154. Alec_C Lv 1 6 pts. 9,314
  5. Avatar for ObeKelly 155. ObeKelly Lv 1 6 pts. 9,305
  6. Avatar for bbmt 156. bbmt Lv 1 6 pts. 9,299
  7. Avatar for agujas 157. agujas Lv 1 6 pts. 9,286
  8. Avatar for EagleGuy 158. EagleGuy Lv 1 6 pts. 9,282
  9. Avatar for samchop 159. samchop Lv 1 6 pts. 9,272
  10. Avatar for enntau 160. enntau Lv 1 6 pts. 9,270

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…