Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122
  7. Avatar for Auburn University BIOL 3000 Genetics 27. Auburn University BIOL 3000 Genetics 1 pt. 5,122
  1. Avatar for marsfan 181. marsfan Lv 1 3 pts. 9,049
  2. Avatar for martinf 182. martinf Lv 1 3 pts. 9,011
  3. Avatar for thewholeblahthing 183. thewholeblahthing Lv 1 3 pts. 8,999
  4. Avatar for NicolasDorn 184. NicolasDorn Lv 1 3 pts. 8,991
  5. Avatar for Auntecedent 185. Auntecedent Lv 1 3 pts. 8,980
  6. Avatar for frostschutz 186. frostschutz Lv 1 3 pts. 8,955
  7. Avatar for pizpot 187. pizpot Lv 1 3 pts. 8,953
  8. Avatar for hansvandenhof 188. hansvandenhof Lv 1 3 pts. 8,947
  9. Avatar for ForrestBC 189. ForrestBC Lv 1 3 pts. 8,926
  10. Avatar for andrehil 190. andrehil Lv 1 3 pts. 8,919

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…