Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122
  7. Avatar for Auburn University BIOL 3000 Genetics 27. Auburn University BIOL 3000 Genetics 1 pt. 5,122
  1. Avatar for zannipietro 191. zannipietro Lv 1 3 pts. 8,899
  2. Avatar for joremen 192. joremen Lv 1 3 pts. 8,891
  3. Avatar for DScott 193. DScott Lv 1 2 pts. 8,885
  4. Avatar for pascal ochem 194. pascal ochem Lv 1 2 pts. 8,879
  5. Avatar for yippee 195. yippee Lv 1 2 pts. 8,869
  6. Avatar for doctaven 196. doctaven Lv 1 2 pts. 8,860
  7. Avatar for trentis1 197. trentis1 Lv 1 2 pts. 8,848
  8. Avatar for Bogden 198. Bogden Lv 1 2 pts. 8,837
  9. Avatar for Aurel Riek 199. Aurel Riek Lv 1 2 pts. 8,833
  10. Avatar for CoolgyFurlough 200. CoolgyFurlough Lv 1 2 pts. 8,831

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…