Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122

  1. Avatar for deconstruct 231. deconstruct Lv 1 1 pt. 8,474
  2. Avatar for Ergsterfalter 232. Ergsterfalter Lv 1 1 pt. 8,474
  3. Avatar for sendasticloop 233. sendasticloop Lv 1 1 pt. 8,469
  4. Avatar for argyrw 234. argyrw Lv 1 1 pt. 8,444
  5. Avatar for alchemis_ 235. alchemis_ Lv 1 1 pt. 8,441
  6. Avatar for SemoKoda 236. SemoKoda Lv 1 1 pt. 8,439
  7. Avatar for DuyguBo 237. DuyguBo Lv 1 1 pt. 8,429
  8. Avatar for drgn_nut 238. drgn_nut Lv 1 1 pt. 8,424
  9. Avatar for Alberi 239. Alberi Lv 1 1 pt. 8,419
  10. Avatar for Aceed 240. Aceed Lv 1 1 pt. 8,414

Comments


O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…