Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122
  7. Avatar for Auburn University BIOL 3000 Genetics 27. Auburn University BIOL 3000 Genetics 1 pt. 5,122
  1. Avatar for jojo2525 241. jojo2525 Lv 1 1 pt. 8,404
  2. Avatar for Dijkgraaf 242. Dijkgraaf Lv 1 1 pt. 8,396
  3. Avatar for Mikisp 243. Mikisp Lv 1 1 pt. 8,383
  4. Avatar for GAVENvonAHYO 244. GAVENvonAHYO Lv 1 1 pt. 8,365
  5. Avatar for lilithness 245. lilithness Lv 1 1 pt. 8,360
  6. Avatar for YellowBearPL 246. YellowBearPL Lv 1 1 pt. 8,356
  7. Avatar for Swapper242 247. Swapper242 Lv 1 1 pt. 8,337
  8. Avatar for Cicero Rodrigues da Silva 248. Cicero Rodrigues da Silva Lv 1 1 pt. 8,334
  9. Avatar for Mika Yu 249. Mika Yu Lv 1 1 pt. 8,328
  10. Avatar for nalattappo 250. nalattappo Lv 1 1 pt. 8,328

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…