Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122
  7. Avatar for Auburn University BIOL 3000 Genetics 27. Auburn University BIOL 3000 Genetics 1 pt. 5,122
  1. Avatar for snowleopard94 251. snowleopard94 Lv 1 1 pt. 8,323
  2. Avatar for BTLSolutions 252. BTLSolutions Lv 1 1 pt. 8,318
  3. Avatar for LouisTran 253. LouisTran Lv 1 1 pt. 8,296
  4. Avatar for Thibzer54 254. Thibzer54 Lv 1 1 pt. 8,288
  5. Avatar for dlchan 255. dlchan Lv 1 1 pt. 8,283
  6. Avatar for perimundo 256. perimundo Lv 1 1 pt. 8,281
  7. Avatar for james_heldmann 257. james_heldmann Lv 1 1 pt. 8,280
  8. Avatar for nilja20 258. nilja20 Lv 1 1 pt. 8,278
  9. Avatar for kludbrook 259. kludbrook Lv 1 1 pt. 8,275
  10. Avatar for Spachtel 260. Spachtel Lv 1 1 pt. 8,263

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…