Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122
  7. Avatar for Auburn University BIOL 3000 Genetics 27. Auburn University BIOL 3000 Genetics 1 pt. 5,122
  1. Avatar for HMK 261. HMK Lv 1 1 pt. 8,250
  2. Avatar for cnrokt 262. cnrokt Lv 1 1 pt. 8,248
  3. Avatar for Katha72 263. Katha72 Lv 1 1 pt. 8,242
  4. Avatar for LT234 264. LT234 Lv 1 1 pt. 8,227
  5. Avatar for Sammy3c2b1a0 265. Sammy3c2b1a0 Lv 1 1 pt. 8,220
  6. Avatar for SNK__mf 266. SNK__mf Lv 1 1 pt. 8,216
  7. Avatar for Hanoman777 267. Hanoman777 Lv 1 1 pt. 8,183
  8. Avatar for ronbu68 268. ronbu68 Lv 1 1 pt. 8,179
  9. Avatar for Erdmaennchen3_0 269. Erdmaennchen3_0 Lv 1 1 pt. 8,173
  10. Avatar for koldo87 270. koldo87 Lv 1 1 pt. 8,162

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…