Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122

  1. Avatar for Yenji 311. Yenji Lv 1 1 pt. 7,385
  2. Avatar for Namexxx 312. Namexxx Lv 1 1 pt. 7,283
  3. Avatar for SuperSommer 313. SuperSommer Lv 1 1 pt. 7,275
  4. Avatar for Ivanda79 314. Ivanda79 Lv 1 1 pt. 7,213
  5. Avatar for arschlecken 315. arschlecken Lv 1 1 pt. 7,180
  6. Avatar for JoSchlo 316. JoSchlo Lv 1 1 pt. 7,125
  7. Avatar for Fr. Geiger 317. Fr. Geiger Lv 1 1 pt. 7,044
  8. Avatar for NorbertM 318. NorbertM Lv 1 1 pt. 6,884
  9. Avatar for brucheta 319. brucheta Lv 1 1 pt. 6,722
  10. Avatar for KevinE 320. KevinE Lv 1 1 pt. 6,397

Comments


O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…