Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122
  7. Avatar for Auburn University BIOL 3000 Genetics 27. Auburn University BIOL 3000 Genetics 1 pt. 5,122
  1. Avatar for Anfinsen_slept_here 51. Anfinsen_slept_here Lv 1 47 pts. 10,051
  2. Avatar for steveB 52. steveB Lv 1 46 pts. 10,049
  3. Avatar for haabermaaster 53. haabermaaster Lv 1 46 pts. 10,049
  4. Avatar for Crossed Sticks 54. Crossed Sticks Lv 1 45 pts. 10,032
  5. Avatar for g_b 55. g_b Lv 1 44 pts. 10,029
  6. Avatar for Steven Pletsch 56. Steven Pletsch Lv 1 43 pts. 10,020
  7. Avatar for Idiotboy 57. Idiotboy Lv 1 43 pts. 10,020
  8. Avatar for Pawel Tluscik 58. Pawel Tluscik Lv 1 42 pts. 10,015
  9. Avatar for alwen 59. alwen Lv 1 41 pts. 10,003
  10. Avatar for Blipperman 60. Blipperman Lv 1 41 pts. 10,001

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…