Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Bad Monkey 21. Bad Monkey 1 pt. 8,610
  2. Avatar for Coastal Biochemistry 22. Coastal Biochemistry 1 pt. 8,280
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,250
  4. Avatar for MantaRayHGEN 24. MantaRayHGEN 1 pt. 5,906
  5. Avatar for CHE222 25. CHE222 1 pt. 5,300
  6. Avatar for Window Group 26. Window Group 1 pt. 5,122
  7. Avatar for Auburn University BIOL 3000 Genetics 27. Auburn University BIOL 3000 Genetics 1 pt. 5,122
  1. Avatar for cbwest 61. cbwest Lv 1 40 pts. 9,985
  2. Avatar for SKSbell 62. SKSbell Lv 1 39 pts. 9,982
  3. Avatar for BootsMcGraw 63. BootsMcGraw Lv 1 39 pts. 9,981
  4. Avatar for xythus 64. xythus Lv 1 38 pts. 9,978
  5. Avatar for jamiexq 65. jamiexq Lv 1 37 pts. 9,977
  6. Avatar for j.wohlmann 66. j.wohlmann Lv 1 37 pts. 9,973
  7. Avatar for fearjuan 67. fearjuan Lv 1 36 pts. 9,960
  8. Avatar for Satina 68. Satina Lv 1 35 pts. 9,947
  9. Avatar for teftatene 69. teftatene Lv 1 35 pts. 9,946
  10. Avatar for Feet1stEvolves 70. Feet1stEvolves Lv 1 34 pts. 9,914

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…