Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Herobrine's Army 100 pts. 10,578
  2. Avatar for Contenders 2. Contenders 83 pts. 10,571
  3. Avatar for Go Science 3. Go Science 68 pts. 10,555
  4. Avatar for Beta Folders 4. Beta Folders 55 pts. 10,496
  5. Avatar for HMT heritage 5. HMT heritage 44 pts. 10,395
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 10,386
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 27 pts. 10,361
  8. Avatar for Gargleblasters 8. Gargleblasters 21 pts. 10,334
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 16 pts. 10,305
  10. Avatar for Team India 10. Team India 12 pts. 10,227

  1. Avatar for TastyMunchies 11. TastyMunchies Lv 1 87 pts. 10,407
  2. Avatar for O Seki To 12. O Seki To Lv 1 86 pts. 10,395
  3. Avatar for Deleted player 13. Deleted player 85 pts. 10,389
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 83 pts. 10,386
  5. Avatar for johnmitch 15. johnmitch Lv 1 82 pts. 10,382
  6. Avatar for robgee 16. robgee Lv 1 81 pts. 10,338
  7. Avatar for Mike Lewis 17. Mike Lewis Lv 1 80 pts. 10,334
  8. Avatar for diamonddays 18. diamonddays Lv 1 79 pts. 10,317
  9. Avatar for nicobul 19. nicobul Lv 1 77 pts. 10,305
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 76 pts. 10,294

Comments


O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…