Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Herobrine's Army 100 pts. 10,578
  2. Avatar for Contenders 2. Contenders 83 pts. 10,571
  3. Avatar for Go Science 3. Go Science 68 pts. 10,555
  4. Avatar for Beta Folders 4. Beta Folders 55 pts. 10,496
  5. Avatar for HMT heritage 5. HMT heritage 44 pts. 10,395
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 10,386
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 27 pts. 10,361
  8. Avatar for Gargleblasters 8. Gargleblasters 21 pts. 10,334
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 16 pts. 10,305
  10. Avatar for Team India 10. Team India 12 pts. 10,227

  1. Avatar for Keresto 31. Keresto Lv 1 65 pts. 10,206
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 64 pts. 10,202
  3. Avatar for spdenne 33. spdenne Lv 1 63 pts. 10,191
  4. Avatar for Scopper 34. Scopper Lv 1 62 pts. 10,178
  5. Avatar for Merf 35. Merf Lv 1 61 pts. 10,177
  6. Avatar for Deet 36. Deet Lv 1 60 pts. 10,146
  7. Avatar for fpc 37. fpc Lv 1 59 pts. 10,135
  8. Avatar for phi16 38. phi16 Lv 1 58 pts. 10,130
  9. Avatar for tangofox10 39. tangofox10 Lv 1 57 pts. 10,116
  10. Avatar for w1seguy 40. w1seguy Lv 1 56 pts. 10,113

Comments


O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…