Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Herobrine's Army 100 pts. 10,578
  2. Avatar for Contenders 2. Contenders 83 pts. 10,571
  3. Avatar for Go Science 3. Go Science 68 pts. 10,555
  4. Avatar for Beta Folders 4. Beta Folders 55 pts. 10,496
  5. Avatar for HMT heritage 5. HMT heritage 44 pts. 10,395
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 10,386
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 27 pts. 10,361
  8. Avatar for Gargleblasters 8. Gargleblasters 21 pts. 10,334
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 16 pts. 10,305
  10. Avatar for Team India 10. Team India 12 pts. 10,227

  1. Avatar for obbo 171. obbo Lv 1 4 pts. 9,167
  2. Avatar for chilifish 172. chilifish Lv 1 4 pts. 9,151
  3. Avatar for Raspberry0987 173. Raspberry0987 Lv 1 4 pts. 9,149
  4. Avatar for Ertonier 174. Ertonier Lv 1 4 pts. 9,131
  5. Avatar for RiaSkies 175. RiaSkies Lv 1 4 pts. 9,120
  6. Avatar for kathy65 176. kathy65 Lv 1 4 pts. 9,116
  7. Avatar for WittiWittmann 177. WittiWittmann Lv 1 4 pts. 9,097
  8. Avatar for Strawberry7 178. Strawberry7 Lv 1 4 pts. 9,086
  9. Avatar for bcre8tvv 179. bcre8tvv Lv 1 3 pts. 9,085
  10. Avatar for klc58 180. klc58 Lv 1 3 pts. 9,074

Comments


O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…