Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Herobrine's Army 100 pts. 10,578
  2. Avatar for Contenders 2. Contenders 83 pts. 10,571
  3. Avatar for Go Science 3. Go Science 68 pts. 10,555
  4. Avatar for Beta Folders 4. Beta Folders 55 pts. 10,496
  5. Avatar for HMT heritage 5. HMT heritage 44 pts. 10,395
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 10,386
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 27 pts. 10,361
  8. Avatar for Gargleblasters 8. Gargleblasters 21 pts. 10,334
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 16 pts. 10,305
  10. Avatar for Team India 10. Team India 12 pts. 10,227

  1. Avatar for klippe 291. klippe Lv 1 1 pt. 7,875
  2. Avatar for romancz6806 292. romancz6806 Lv 1 1 pt. 7,866
  3. Avatar for Serca 293. Serca Lv 1 1 pt. 7,864
  4. Avatar for monichen50 294. monichen50 Lv 1 1 pt. 7,842
  5. Avatar for Wellensittich 295. Wellensittich Lv 1 1 pt. 7,830
  6. Avatar for quadrifoglio 296. quadrifoglio Lv 1 1 pt. 7,733
  7. Avatar for Texing 297. Texing Lv 1 1 pt. 7,704
  8. Avatar for jackymaus35 298. jackymaus35 Lv 1 1 pt. 7,656
  9. Avatar for MisterY 299. MisterY Lv 1 1 pt. 7,632
  10. Avatar for fanchquebec 300. fanchquebec Lv 1 1 pt. 7,619

Comments


O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…